PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA61G00485
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family MYB
Protein Properties Length: 272aa    MW: 30593.6 Da    PI: 6.2545
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA61G00485genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.85.8e-191461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEde+lvd++k+ G g+W+t ++  g+ R++k+c++rw +yl
       AA61G00485 14 KGPWTPEEDEILVDYIKKNGHGSWRTLPKLAGLLRCGKSCRLRWTNYL 61
                     79******************************99************97 PP

2Myb_DNA-binding52.41.2e-1667112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T eE++l v++++ lG++ W++Ia+ ++ gRt++++k+ w+++l
       AA61G00485  67 RGPFTSEEEKLVVQLHAILGNR-WAAIAAQLP-GRTDNEIKNLWNTHL 112
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.2E-25564IPR009057Homeodomain-like
PROSITE profilePS5129418.565961IPR017930Myb domain
SuperFamilySSF466899.36E-3111108IPR009057Homeodomain-like
SMARTSM007173.9E-141363IPR001005SANT/Myb domain
PfamPF002492.8E-161461IPR001005SANT/Myb domain
CDDcd001674.94E-111661No hitNo description
PROSITE profilePS5129425.2562116IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.2E-2665116IPR009057Homeodomain-like
SMARTSM007171.2E-1466114IPR001005SANT/Myb domain
PfamPF002493.8E-1567112IPR001005SANT/Myb domain
CDDcd001677.15E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0009909Biological Processregulation of flower development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 272 aa     Download sequence    Send to blast
MGRTPCCDKK GLKKGPWTPE EDEILVDYIK KNGHGSWRTL PKLAGLLRCG KSCRLRWTNY  60
LRPDIKRGPF TSEEEKLVVQ LHAILGNRWA AIAAQLPGRT DNEIKNLWNT HLKKRLLCMG  120
LDPKTHEPLT SSYGLIKQTP ASPATRHMAQ WESARLEAEA RLSKESMLFT SSPSAKPDCD  180
HFLRIWNSEI GESFRNLNRL DESTTKSSSK VINGCSDSSP CSNNVEEEDD SSDSALQLLL  240
DFPISDDDMS FLEENIQSYT DSTMDVSMVS SL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-30121165108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00114ampDAPTransfer from AT3G61250Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006402502.11e-157hypothetical protein EUTSA_v10006126mg
SwissprotQ8GWP01e-66MYB39_ARATH; Transcription factor MYB39
TrEMBLV4L0Z81e-157V4L0Z8_EUTSA; Uncharacterized protein
STRINGfgenesh1_pm.C_scaffold_50021021e-154(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM69822643
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61250.11e-148myb domain protein 17